Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutathione transferase (GST)
LigandBDBM4078
Substrate/Competitorn/a
Meas. Tech.GST Assay
IC50 5.0e+4± 0 nM
Citation Mangoyi RHayeshi RNgadjui BNgandeu FBezabih MAbegaz BRazafimahefa SRasoanaivo PMukanganyama S Glutathione transferase from Plasmodium falciparum--interaction with malagashanine and selected plant natural products. J Enzyme Inhib Med Chem 25:854-62 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutathione transferase (GST)
Name:Glutathione S-transferase Pi
Synonyms:GST class-pi | GSTP1-1 | Glutathione S-transferase | Glutathione S-transferase (GST) | Glutathione S-transferase P
Type:Enzyme
Mol. Mass.:23353.53
Organism:Homo sapiens (Human)
Description:P09211
Residue:210
Sequence:
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VGRLSARPKLKAFLASPEYVNLPINGNGKQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM4078
n/a
NameBDBM4078
Synonyms:6,7,13,14-tetrahydroxy-2,9-dioxatetracyclo[6.6.2.0^{4,16}.0^{11,15}]hexadeca-1(14),4(16),5,7,11(15),12-hexaene-3,10-dione | CHEMBL6246 | ELLAGIC ACID | Elagic Acid | Ellagic acid (18) | Ellagic acid dihydrate | MLS000069632 | SMR000058244 | cid_5281855
TypeSmall organic molecule
Emp. Form.C14H6O8
Mol. Mass.302.1926
SMILESOc1cc2c3c(oc(=O)c4cc(O)c(O)c(oc2=O)c34)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: