| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Glutathione S-transferase P |
|---|
| Ligand | BDBM50140172 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | GST Assay |
|---|
| IC50 | 6.9e+4±n/a nM |
|---|
| Citation |  Mangoyi, R; Hayeshi, R; Ngadjui, B; Ngandeu, F; Bezabih, M; Abegaz, B; Razafimahefa, S; Rasoanaivo, P; Mukanganyama, S Glutathione transferase from Plasmodium falciparum--interaction with malagashanine and selected plant natural products. J Enzyme Inhib Med Chem25:854-62 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Glutathione S-transferase P |
|---|
| Name: | Glutathione S-transferase P |
|---|
| Synonyms: | FAEES3 | GST class-pi | GST3 | GSTP1 | GSTP1-1 | GSTP1_HUMAN | Glutathione S-transferase | Glutathione S-transferase (GST) | Glutathione S-transferase P | Glutathione S-transferase Pi | Glutathione transferase (GST) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23353.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P09211 |
|---|
| Residue: | 210 |
|---|
| Sequence: | MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VGRLSARPKLKAFLASPEYVNLPINGNGKQ
|
|
|
|---|
| BDBM50140172 |
|---|
| n/a |
|---|
| Name | BDBM50140172 |
|---|
| Synonyms: | CHEBI:3962 | CHEMBL140 | Curcumin | US9409845, Table 1, Compound 21: curcumin |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H20O6 |
|---|
| Mol. Mass. | 368.3799 |
|---|
| SMILES | COc1cc(\C=C\C(=O)CC(=O)\C=C\c2ccc(O)c(OC)c2)ccc1O |
|---|
| Structure | 
|
|---|
Search and Browse
