Reaction Details |
| Report a problem with these data |
Target | Glutathione S-transferase P |
---|
Ligand | BDBM209868 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | GST Assay |
---|
IC50 | 4e+3±n/a nM |
---|
Citation | Mangoyi, R; Hayeshi, R; Ngadjui, B; Ngandeu, F; Bezabih, M; Abegaz, B; Razafimahefa, S; Rasoanaivo, P; Mukanganyama, S Glutathione transferase from Plasmodium falciparum--interaction with malagashanine and selected plant natural products. J Enzyme Inhib Med Chem25:854-62 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Glutathione S-transferase P |
---|
Name: | Glutathione S-transferase P |
Synonyms: | FAEES3 | GST class-pi | GST3 | GSTP1 | GSTP1-1 | GSTP1_HUMAN | Glutathione S-transferase | Glutathione S-transferase (GST) | Glutathione S-transferase P | Glutathione S-transferase Pi | Glutathione transferase (GST) |
Type: | Enzyme |
Mol. Mass.: | 23353.53 |
Organism: | Homo sapiens (Human) |
Description: | P09211 |
Residue: | 210 |
Sequence: | MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VGRLSARPKLKAFLASPEYVNLPINGNGKQ
|
|
|
BDBM209868 |
---|
n/a |
---|
Name | BDBM209868 |
Synonyms: | 3-[18-(2-carboxyethyl)-8,13-bis(ethenyl)-3,7,12,17-tetramethylporphyrin-21,24-diid-2-yl]propanoic acid;iron(2+) | Haemin | Heme |
Type | Small organic molecule |
Emp. Form. | C34H32N4O4 |
Mol. Mass. | 560.6434 |
SMILES | Cc1c(C=C)c2cc3[n-]c(cc4[n-]c(cc5nc(cc1n2)c(C=C)c5C)c(C)c4CCC(O)=O)c(CCC(O)=O)c3C |
Structure |
|