Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeucine aminopeptidase (LAP)
LigandBDBM234298
Substrate/Competitorn/a
Meas. Tech.Kinetic Inhibition Assay
pH8.4±0
Temperature298.15±0 K
Ki 2.687e+5± 0 nM
Citation Pícha JLiboska RBude?ínský MJirácek JPawelczak MMucha A Unusual activity pattern of leucine aminopeptidase inhibitors based on phosphorus containing derivatives of methionine and norleucine. J Enzyme Inhib Med Chem 26:155-61 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leucine aminopeptidase (LAP)
Name:Leucine aminopeptidase (LAP)
Synonyms:Cytosol aminopeptidase
Type:Enzyme
Mol. Mass.:4015.44
Organism:Sus scrofa (Pig)
Description:P28839
Residue:36
Sequence:
TKGLVLGIYSKEKEDDAPQFTSAGENFDKWVSGKLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM234298
n/a
NameBDBM234298
Synonyms:Nle-ψ[P(O)(OH)O]-L-Ala (6)
TypeSmall organic molecule
Emp. Form.C8H18NO5P
Mol. Mass.239.206
SMILESCCCCC(N)P(O)(=O)O[C@@H](C)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: