| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cytosol aminopeptidase [33-68,L62W] |
|---|
| Ligand | BDBM234299 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Kinetic Inhibition Assay |
|---|
| pH | 8.4±0 |
|---|
| Temperature | 298.15±0 K |
|---|
| Ki | 2.19e+5±n/a nM |
|---|
| Citation |  Pícha, J; Liboska, R; Bude?ínský, M; Jirácek, J; Pawelczak, M; Mucha, A Unusual activity pattern of leucine aminopeptidase inhibitors based on phosphorus containing derivatives of methionine and norleucine. J Enzyme Inhib Med Chem26:155-61 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cytosol aminopeptidase [33-68,L62W] |
|---|
| Name: | Cytosol aminopeptidase [33-68,L62W] |
|---|
| Synonyms: | AMPL_PIG | Cytosol aminopeptidase | LAP3 | Leucine aminopeptidase (LAP) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 4015.44 |
|---|
| Organism: | Sus scrofa (Pig) |
|---|
| Description: | P28839[33-68,L62W] |
|---|
| Residue: | 36 |
|---|
| Sequence: | TKGLVLGIYSKEKEDDAPQFTSAGENFDKWVSGKLR
|
|
|
|---|
| BDBM234299 |
|---|
| n/a |
|---|
| Name | BDBM234299 |
|---|
| Synonyms: | Nle-ψ[P(O)(OH)O]-L-AlaOMe (7) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H20NO5P |
|---|
| Mol. Mass. | 253.2326 |
|---|
| SMILES | CCCCC(N)P(O)(=O)O[C@@H](C)C(=O)OC |r| |
|---|
| Structure | 
|
|---|
Search and Browse
