Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUridine-5'-diphosphoglucuronosyltransferase 1A6
LigandBDBM21361
Substrate/Competitor1-Naphthol
Meas. Tech.UDP-glucuronosyltransferase Activity Assay
IC50>3.00e+5± 0 nM
Citation Liu YShe MWu ZDai R The inhibition study of human UDP-glucuronosyltransferases with cytochrome P450 selective substrates and inhibitors. J Enzyme Inhib Med Chem 26:386-93 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Uridine-5'-diphosphoglucuronosyltransferase 1A6
Name:Uridine-5'-diphosphoglucuronosyltransferase 1A6
Synonyms:Phenol-metabolizing UDP-glucuronosyltransferase | UDP-glucuronosyltransferase 1-6 | UDP-glucuronosyltransferase 1-F | UDP-glucuronosyltransferase 1A6 | UDPGT 1-6 | UGT-1F | UGT1*6 | UGT1-06 | UGT1.6 | UGT1F
Type:Enzyme
Mol. Mass.:60765.14
Organism:Homo sapiens (Human)
Description:P19224
Residue:532
Sequence:
MACLLRSFQRISAGVFFLALWGMVVGDKLLVVPQDGSHWLSMKDIVEVLSDRGHEIVVVV
PEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIG
LYFINCQSLLQDRDTLNFFKESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEH
TFSRSPDPVSYIPRCYTKFSDHMTFSQRVANFLVNLLEPYLFYCLFSKYEELASAVLKRD
VDIITLYQKVSVWLLRYDFVLEYPRPVMPNMVFIGGINCKKRKDLSQEFEAYINASGEHG
IVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLL
GHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSE
DLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDL
TWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21361
1-Naphthol
NameBDBM21361
Synonyms:(5S)-5-Ethyl-3-methyl-5-phenyl-2,4-imidazolidinedione | (5S)-5-ethyl-3-methyl-5-phenylimidazolidine-2,4-dione | Mephenytoin, D- | S-Mephenytoin | S-mephentoin
TypeSmall organic molecule
Emp. Form.C12H14N2O2
Mol. Mass.218.2518
SMILESCC[C@]1(NC(=O)N(C)C1=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: