Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUridine-5'-diphosphoglucuronosyltransferase 1A6
LigandBDBM50241343
Substrate/Competitor1-Naphthol
Meas. Tech.UDP-glucuronosyltransferase Activity Assay
IC50 1.85e+5± 8.6e+4 nM
Citation Liu YShe MWu ZDai R The inhibition study of human UDP-glucuronosyltransferases with cytochrome P450 selective substrates and inhibitors. J Enzyme Inhib Med Chem 26:386-93 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Uridine-5'-diphosphoglucuronosyltransferase 1A6
Name:Uridine-5'-diphosphoglucuronosyltransferase 1A6
Synonyms:Phenol-metabolizing UDP-glucuronosyltransferase | UDP-glucuronosyltransferase 1-6 | UDP-glucuronosyltransferase 1-F | UDP-glucuronosyltransferase 1A6 | UDPGT 1-6 | UGT-1F | UGT1*6 | UGT1-06 | UGT1.6 | UGT1F
Type:Enzyme
Mol. Mass.:60765.14
Organism:Homo sapiens (Human)
Description:P19224
Residue:532
Sequence:
MACLLRSFQRISAGVFFLALWGMVVGDKLLVVPQDGSHWLSMKDIVEVLSDRGHEIVVVV
PEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIG
LYFINCQSLLQDRDTLNFFKESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEH
TFSRSPDPVSYIPRCYTKFSDHMTFSQRVANFLVNLLEPYLFYCLFSKYEELASAVLKRD
VDIITLYQKVSVWLLRYDFVLEYPRPVMPNMVFIGGINCKKRKDLSQEFEAYINASGEHG
IVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLL
GHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSE
DLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDL
TWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50241343
1-Naphthol
NameBDBM50241343
Synonyms:(RS)-6-methoxy-2-((4-methoxy-3,5-dimethylpyridin-2-yl) methylsulfinyl)-1H-benzo[d]imidazole | (omeprazole)5-Methoxy-2-(4-methoxy-3,5-dimethyl-pyridin-2-ylmethanesulfinyl)-1H-benzoimidazole | 2-(3-methoxy-2,4-dimethylbenzylsulfinyl)-6-methoxy-1H-benzo[d]imidazole | 5-Methoxy-2-(4-methoxy-3,5-dimethyl-pyridin-2-ylmethanesulfinyl)-1H-benzoimidazole | 5-Methoxy-2-(4-methoxy-3,5-dimethyl-pyridin-2-ylmethanesulfinyl)-1H-benzoimidazole (omeprazole) | 5-Methoxy-2-(4-methoxy-3,5-dimethyl-pyridin-2-ylmethanesulfinyl)-1H-benzoimidazole(omeprazole) | 5-methoxy-2-((4-methoxy-3,5-dimethylpyridin-2-yl)methylsulfinyl)-1H-benzo[d]imidazole | 5-methoxy-2-(2-(4-methoxy-3,5-dimethylpyridin-2-yl)ethylsulfinyl)-1H-benzo[d]imidazole | 6-methoxy-2-((4-methoxy-3,5-dimethylpyridin-2-yl)methylsulfinyl)-1H-benzo[d]imidazole | CHEMBL1503 | ESOMEPRAZOLE SODIUM | H-168/68 | OMEPRAZOLE | Omeprazole (OMP) | Prilosec | cid_4594
TypeSmall organic molecule
Emp. Form.C17H19N3O3S
Mol. Mass.345.416
SMILESCOc1ccc2nc([nH]c2c1)S(=O)Cc1ncc(C)c(OC)c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: