Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetL-lactate:NAD+ oxidoreductase B (LDH-B4)
LigandBDBM234447
Substrate/Competitorn/a
Meas. Tech.LDH Activity Assay
pH7.4±n/a
IC50 14500000±n/a nM
Commentsextracted
Citation Rodríguez-Páez LChena-Taboada MACabrera-Hernández ACordero-Martínez JWong C Oxamic acid analogues as LDH-C4-specific competitive inhibitors. J Enzyme Inhib Med Chem 26:579-86 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
L-lactate:NAD+ oxidoreductase B (LDH-B4)
Name:L-lactate:NAD+ oxidoreductase B (LDH-B4)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:36569.37
Organism:Mus musculus (Mouse)
Description:P16125
Residue:334
Sequence:
MATLKEKLIASVADDEAAVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLK
GEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKF
IIPQIVKYSPDCTIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLG
IHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVDSAY
EVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG
LTSVINQKLKDDEVAQLRKSADTLWDIQKDLKDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM234447
n/a
NameBDBM234447
Synonyms:N-sec-Butyl oxamate
TypeSmall organic molecule
Emp. Form.C6H10NO3
Mol. Mass.144.149
SMILESCCC(C)NC(=O)C([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: