Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProlylcarboxypeptidase (PRCP)
LigandBDBM235950
Substrate/Competitorn/a
Meas. Tech.Enzyme Activity Assay
pH5.5±n/a
IC50 0.051±n/a nM
Commentsextracted
Citation Hale JJJiang JShen DShi ZShu MWu ZYang C Prolylcarboxypeptidase inhibitors US Patent  US9365539 Publication Date 6/14/2016
More Info.:Get all data from this article,  Assay Method
 
Prolylcarboxypeptidase (PRCP)
Name:Lysosomal Pro-X carboxypeptidase
Synonyms:Angiotensinase C | Lysosomal carboxypeptidase C | PRCP | Proline carboxypeptidase | Prolylcarboxypeptidase
Type:Enzyme
Mol. Mass.:55805.19
Organism:Homo sapiens (Human)
Description:P42785
Residue:496
Sequence:
MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHF
GFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFA
EHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSY
GGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRS
WDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYPYASNFLQP
LPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETATSSLGTLGWS
YQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHT
NIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRH
MKNWIRDFYDSAGKQH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM235950
n/a
NameBDBM235950
Synonyms:US9365539, 1
TypeSmall organic molecule
Emp. Form.C26H26ClN5
Mol. Mass.443.971
SMILESClc1ccc(cc1)-c1cc(C2CCN(CCc3ccccc3)CC2)n(n1)-c1ncccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: