Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 10A (PDE10A2)
LigandBDBM236019
Substrate/Competitorn/a
Meas. Tech.Fluorescence Polarization Assay
pH7.2±n/a
Temperature298.15±n/a K
Ki 0.065±n/a nM
Commentsextracted
Citation Cox CDBeshore DCKim JJKuduk SDMcVean CAReger TSheen JT 1,3 substituted azetidine PDE10 inhibitors US Patent  US9365562 Publication Date 6/14/2016
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 10A (PDE10A2)
Name:Phosphodiesterase 10A (PDE10A2)
Synonyms:Phosphodiesterase 10A | Phosphodiesterase 10A2 | Phosphodiesterase 10A2 (PDE10A)
Type:Enzyme
Mol. Mass.:89387.03
Organism:Homo sapiens (Human)
Description:Q9Y233-2
Residue:789
Sequence:
MEDGPSNNASCFRRLTECFLSPSLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRK
NNKSEDESAPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKAD
GFALYFLGECNNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGD
ERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWA
SVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALF
QVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADP
RFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCAL
ALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIG
PFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAI
LQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTV
SILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQS
HRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKD
EVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSV
AQKAAASED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM236019
n/a
NameBDBM236019
Synonyms:US9365562, 57
TypeSmall organic molecule
Emp. Form.C26H24F2N8
Mol. Mass.486.5192
SMILESCc1nc(Cc2cc(F)ccc2F)n(n1)-c1cc(nc(C)n1)N1CC(C1)c1nc2ccccc2n1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: