| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cellular tumor antigen p53 [18-26]/E3 ubiquitin-protein ligase Mdm2 [2-188] |
|---|
| Ligand | BDBM236368 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Time Resolved Fluorescence Energy Transfer (TR-FRET) Assay |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 0.087±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Cotesta, S; Furet, P; Guagnano, V; Holzer, P; Kallen, J; Mah, R; Masuya, K; Schlapbach, A; Stutz, S; Vaupel, A Pyrrolopyrrolidinone compounds US Patent US9365576 Publication Date 6/14/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cellular tumor antigen p53 [18-26]/E3 ubiquitin-protein ligase Mdm2 [2-188] |
|---|
| Name: | Cellular tumor antigen p53 [18-26]/E3 ubiquitin-protein ligase Mdm2 [2-188] |
|---|
| Synonyms: | p53-MDM2 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Cellular tumor antigen p53 [18-26] |
|---|
| Synonyms: | P53 | P53_HUMAN | TP53 | Tumor suppressor p53 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 1122.31 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | aa 18-26 |
|---|
| Residue: | 9 |
|---|
| Sequence: | |
|---|
| Component 2 |
| Name: | E3 ubiquitin-protein ligase Mdm2 [2-188] |
|---|
| Synonyms: | E3 ubiquitin-protein ligase Mdm2 | MDM2 | MDM2_HUMAN |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 21187.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | aa 2-188 |
|---|
| Residue: | 187 |
|---|
| Sequence: | CNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYI
MTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTS
VSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQR
KRHKSDS
|
|
|
|---|
| BDBM236368 |
|---|
| n/a |
|---|
| Name | BDBM236368 |
|---|
| Synonyms: | US9365576, 121 | US9365576, 218 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H25Cl2N5O4 |
|---|
| Mol. Mass. | 554.425 |
|---|
| SMILES | COc1ncc(-c2cc3C(=O)N([C@H](c3n2C(C)C)c2ccc(Cl)cc2)c2cc(Cl)c(=O)n(C)c2)c(OC)n1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
