Reaction Details |
| Report a problem with these data |
Target | Suppressor of tumorigenicity 14 protein [596-855] |
---|
Ligand | BDBM236492 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Inhibition Enzymatic Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 298.15±n/a K |
---|
Ki | 9.5±1.3 nM |
---|
Comments | extracted |
---|
Citation | Richter, M; Leduc, R; Colombo, E; Marsault, E Matriptase inhibitors and uses thereof against orthomyxoviridae infections US Patent US9365853 Publication Date 6/14/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Suppressor of tumorigenicity 14 protein [596-855] |
---|
Name: | Suppressor of tumorigenicity 14 protein [596-855] |
Synonyms: | Matriptase | PRSS14 | SNC19 | ST14 | ST14_HUMAN | TADG15 |
Type: | Enzyme |
Mol. Mass.: | 28561.29 |
Organism: | Homo sapiens (Human) |
Description: | amino acids 596-855 |
Residue: | 260 |
Sequence: | GSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAA
HCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALL
ELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTT
CENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNK
PGVYTRLPLFRDWIKENTGV
|
|
|
BDBM236492 |
---|
n/a |
---|
Name | BDBM236492 |
Synonyms: | US9365853, 3 |
Type | Small organic molecule |
Emp. Form. | C27H42N10O5S |
Mol. Mass. | 618.751 |
SMILES | C[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)c1nc2ccccc2s1 |r| |
Structure |
|