| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587,Q496K] |
|---|
| Ligand | BDBM293267 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Inhibition of HIV Replication |
|---|
| pH | 7.55±n/a |
|---|
| EC50 | 550±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Kadow, JF; Naidu, BN; Tu, Y Pyridin-3-yl acetic acid derivatives as inhibitors of human immunodeficiency virus replication US Patent US10106504 Publication Date 10/23/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587,Q496K] |
|---|
| Name: | Gag-Pol polyprotein [489-587,Q496K] |
|---|
| Synonyms: | HIV-1 Protease Chain A | HIV-1 Protease NL4-3 | POL_HV1N5 | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10823.26 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P12497[489-587,Q496K] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM293267 |
|---|
| n/a |
|---|
| Name | BDBM293267 |
|---|
| Synonyms: | US10106504, Example 4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C41H43NO7 |
|---|
| Mol. Mass. | 661.7826 |
|---|
| SMILES | COc1ccc(COc2ccc(cc2)-c2c(C)nc(C)c([C@H](OC(C)(C)C)C(O)=O)c2-c2ccc(OCc3ccc(OC)cc3)cc2)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
