Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCAMK2A
LigandBDBM236557
Substrate/Competitorn/a
Meas. Tech.Mobility Shift Assay
pH7.5±n/a
Temperature301.15±n/a K
IC50>10000±n/a nM
Commentsextracted
Citation Wu FShu C PI3K and/or mTOR inhibitor US Patent  US9365572 Publication Date 6/14/2016
More Info.:Get all data from this article,  Assay Method
 
CAMK2A
Name:CAMK2A
Synonyms:CaM kinase II | CaM kinase II alpha | Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2a)
Type:Enzyme Catalytic Domain
Mol. Mass.:54093.63
Organism:Homo sapiens (Human)
Description:gi_25952118
Residue:478
Sequence:
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM236557
n/a
NameBDBM236557
Synonyms:US9365572, 5
TypeSmall organic molecule
Emp. Form.C22H13F3N6O2
Mol. Mass.450.3728
SMILESNc1ccc(cn1)-c1ccc2ncc3c(n(-c4cccc(c4)C(F)(F)F)c(=O)[nH]c3=O)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: