Reaction Details |
| Report a problem with these data |
Target | Carbonic anhydrase 1 |
---|
Ligand | BDBM50149238 |
---|
Substrate/Competitor | 4-Nitrophenyl acetate (NPA) |
---|
Meas. Tech. | Esterase Activity Assay |
---|
Ki | 1.954e+4±n/a nM |
---|
Citation | Kazancioglu, EA; Güney, M; Sentürk, M; Supuran, CT Simple methanesulfonates are hydrolyzed by the sulfatase carbonic anhydrase activity. J Enzyme Inhib Med Chem27:880-5 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Carbonic anhydrase 1 |
---|
Name: | Carbonic anhydrase 1 |
Synonyms: | CA-I | CA1 | CAB | CAH1_HUMAN | Carbonate dehydratase I | Carbonic anhydrase | Carbonic anhydrase 1 (CA I) | Carbonic anhydrase 1 (CA-I) | Carbonic anhydrase 1 (Recombinant CA I) | Carbonic anhydrase 2 (CA II) | Carbonic anhydrase B | Carbonic anhydrase I | Carbonic anhydrase I (CA I) | Carbonic anhydrase I (CA-I) | Carbonic anhydrase I (CAI) | Carbonic anhydrase I (hCA I) | Carbonic anhydrase isoenzyme I (hCA I) | hCA |
Type: | Enzyme |
Mol. Mass.: | 28873.37 |
Organism: | Homo sapiens (Human) |
Description: | P00915 |
Residue: | 261 |
Sequence: | MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
|
|
|
BDBM50149238 |
---|
4-Nitrophenyl acetate (NPA) |
---|
Name | BDBM50149238 |
Synonyms: | 4-Hydroxybiphenyl | 4-Phenylphenol | 4-biphenylol | 4-diphenylol | 4-hydroxydiphenyl | Biphenyl-4-ol (8) | CHEMBL73380 | [1,1'-biphenyl]-4-ol | biphenyl-4-ol | p-biphenylol | p-hydroxybiphenyl | p-hydroxydiphenyl | p-phenylphenol | para-hydroxydiphenyl | para-phenylphenol |
Type | Small organic molecule |
Emp. Form. | C12H10O |
Mol. Mass. | 170.2072 |
SMILES | Oc1ccc(cc1)-c1ccccc1 |
Structure |
|