Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 4
LigandBDBM237299
Substrate/Competitor4-Nitrophenyl acetate (NPA)
Meas. Tech.Esterase Activity Assay
Ki 8.4e+2± 0 nM
Citation Kazancioglu EAGüney MSentürk MSupuran CT Simple methanesulfonates are hydrolyzed by the sulfatase carbonic anhydrase activity. J Enzyme Inhib Med Chem 27:880-5 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 4
Name:Carbonic anhydrase
Synonyms:CA-IV | Carbonate dehydratase IV | Carbonic anhydrase 4 (CA IV) | Carbonic anhydrase IV (CA IV)
Type:Enzyme
Mol. Mass.:35037.98
Organism:Homo sapiens (Human)
Description:P22748
Residue:312
Sequence:
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTK
AKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSD
LPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
QPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFRE
PIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
PMLACLLAGFLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM237299
4-Nitrophenyl acetate (NPA)
NameBDBM237299
Synonyms:Ethoxzolamide (EZA)
TypeSmall organic molecule
Emp. Form.C10H12N2O3S2
Mol. Mass.272.344
SMILESCCOc1ccc2nc(CS(N)(=O)=O)sc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: