| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM239078 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Functional Assay |
|---|
| Ki | 0.81±0.4 nM |
|---|
| Citation |  Prather, PL; Prisinzano, TE; Fantegrossi, WE; Brents, LK; Moran, J; Radominska-Pandya, A; Vasiljevik, T Use of the aminoalkylindole JWH-073-M4 and related compounds as neutral CB1 receptor antagonists for the treatment of alcoholism, drug abuse, obesity, and obesity-related diseases US Patent US9416103 Publication Date 8/16/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM239078 |
|---|
| n/a |
|---|
| Name | BDBM239078 |
|---|
| Synonyms: | US9416103, TV-5-157 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H23NO2 |
|---|
| Mol. Mass. | 357.4449 |
|---|
| SMILES | CCCCn1cc(C(=O)c2cccc3ccccc23)c2cccc(OC)c12 |
|---|
| Structure | 
|
|---|
Search and Browse
