Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 3 (CA III)
LigandBDBM239161
Substrate/Competitorn/a
Meas. Tech.Esterase Activity Assay
pH7.4±n/a
Ki 2.18e+3± 0 nM
Commentsextracted
Citation Koz ÿEkinci DPerrone APiacente SAlankus-aliskan ÿBedir ESupuran CT Analysis of saponins and phenolic compounds as inhibitors of a-carbonic anhydrase isoenzymes. J Enzyme Inhib Med Chem 28:412-7 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 3 (CA III)
Name:Carbonic anhydrase 3 (CA III)
Synonyms:CA-III | Carbonate dehydratase III | Carbonic anhydrase 3 | Carbonic anhydrase III
Type:Enzyme
Mol. Mass.:29376.92
Organism:Bos taurus (Cattle)
Description:Q3SZX4
Residue:260
Sequence:
MAKEWGYADHNGPDHWHELFPNAKGENQSPIELNTKEISHDPSLKPWTASYDPGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLAAPYRLRQFHLHWGSSDDHGSEHSVDGVKYAAELHL
VHWNSKYNSYATALKHADGIAVVGVFLKIGREKGEFQLLLDALDKIKTKGKEAPFNNFNP
SCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPITVSSDQIAKLRTLYSSAENEPPVPL
VRNWRPPQPIKGRIVKASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM239161
n/a
NameBDBM239161
Synonyms:α-CA inhibitor, 9
TypeSmall organic molecule
Emp. Form.C46H74O18
Mol. Mass.915.069
SMILESCC1(C)C[C@@H](O)[C@]2(C)CC[C@]3(C)C(=CCC4[C@@]5(C)CC[C@H](O[C@@H]6OC([C@@H](O)C(O)[C@@H]6O[C@@H]6OC[C@@H](O)[C@H](O)C6O[C@@H]6OC(O)[C@H](O)[C@H](O)C6O)C(O)=O)[C@](C)(CO)C5CC[C@@]34C)C2C1 |r,c:12|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: