| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Siderophore-binding protein |
|---|
| Ligand | BDBM10857 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | CA Inhibition Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| Ki | 7.11e+3±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Maresca, A; Vullo, D; Scozzafava, A; Manole, G; Supuran, CT Inhibition of the ß-class carbonic anhydrases from Mycobacterium tuberculosis with carboxylic acids. J Enzyme Inhib Med Chem28:392-6 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Siderophore-binding protein |
|---|
| Name: | Siderophore-binding protein |
|---|
| Synonyms: | β-Carbonic anhydrase 3 (CA 3) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 17663.22 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | n/a |
|---|
| Residue: | 174 |
|---|
| Sequence: | MPLFSFEGRSPRIDPTAFVAPTATLIGDVTIEAGASVWFNAVLRGDYAPVVVREGANVQD
GAVLHAPPGIPVDIGPGATVAHLCVIHGVHVGSEALIANHATVLDGAVIGARCMIAAGAL
VVAGTQIPAGMLVTGAPAKVKGPIEGTGAEMWVNVNPQAYRDLAARHLAGLEPM
|
|
|
|---|
| BDBM10857 |
|---|
| n/a |
|---|
| Name | BDBM10857 |
|---|
| Synonyms: | 4-aminobenzene-1-sulfonamide | CHEMBL21 | Sulfanilamide | aromatic sulfonamide compound 5 | aromatic/heteroaromatic sulfonamide 2 | halogenosulfanilamide deriv. 5a |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C6H8N2O2S |
|---|
| Mol. Mass. | 172.205 |
|---|
| SMILES | Nc1ccc(cc1)S(N)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
