Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVEGFR-2 (KDR)
LigandBDBM6433
Substrate/CompetitorBiotinylated VEGF-R Peptide Substrate
Meas. Tech.Kinase Inhibition Assay
IC50 500±n/a nM
Citation Kuo GHWang AEmanuel SDeangelis AZhang RConnolly PJMurray WVGruninger RHSechler JFuentes-Pesquera AJohnson DMiddleton SAJolliffe LChen X Synthesis and discovery of pyrazine-pyridine biheteroaryl as a novel series of potent vascular endothelial growth factor receptor-2 inhibitors. J Med Chem 48:1886-900 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
VEGFR-2 (KDR)
Name:VEGFR-2 (KDR)
Synonyms:Fetal liver kinase 1
Type:Receptor Tyrosine Kinase
Mol. Mass.:150388.56
Organism:Rattus norvegicus (rat)
Description:VEGF-R is a fusion protein containing a polyhistidine tag at the N-terminus followed by amino acids 786-1343 of the rat VEGF-R2 kinase domain.
Residue:1343
Sequence:
MESRALLAVALWFCVETRAASVGLPGDSLHPPKLSTQKDILTILANTTLQITCRGQRDLD
WLWPNTPRDSEERVLVTECGDSIFCKTLTVPRVVGNDTGAYKCFYRDTDVSSIVYVYVQD
HRSPFIASVSDEHGIVYITENKNKTVVIPCRGSISNLNVSLCARYPEKRFVPDGNRISWD
SEKGFTIPSYMISYAGMVFCEAKINDETYQSIMYIVLVVGYRIYDVVLSPPHEIELSAGE
KLVLNCTARTELNVGLDFSWQFPSSKHQHKKIVNRDVKSLPGTVAKMFLSTLTIDSVTKS
DQGEYTCTAYSGLMTKKNKTFVRVHTKPFIAFGSGMKSLVEATVGSQVRIPVKYLSYPAP
DIKWYRNGRPIESNYTMIVGDELTIMEVSERDAGNYTVILTNPISMEKQSHMVSLVVNVP
PQIGEKALISPMDSYQYGTMQTLTCTVYANPPLHHIQWYWQLEEACSYRPSQTNPYTCKE
WRHVKDFQGGNKIEVTKNQYALIEGKNKTVSTLVIQAAYVSALYKCEAINKAGRGERVIS
FHVIRGPEITVQPATQPTERESMSLLCTADRNTFENLTWYKLGSQATSVHMGESLTPVCK
NLDALWKLNGTVFSNSTNDILIVAFQNASLQDQGNYVCSAQDKKTKKRHCLVKQLVILER
MAPMITGNLENQTTTIGETIEVVCPTSGNPTPLITWFKDNETLVEDSGIVLKDGNRNLTI
RRVRKEDGGLYTCQACNVLGCARAETLFIIEGVQEKTNLEVIILVGTAVIAMFFWLLLVI
LVRTVKRANEGELKTGYLSIVMDPDELPLDERCERLPYDASKWEFPRDRLKLGKPLGRGA
FGQVIEADAFGIDKTATCKTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGA
CTKPGGPLMVIVEFCKFGNLSTYLRGKRNEFVPYKSKGARFRSGKDYVGELSVDLKRRLD
SITSSQSSASSGFVEEKSLSDVEEEEASEELYKDFLTLEHLICYSFQVAKGMEFLASRKC
IHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDPRLPLKWMAPETIFDRIYTI
QSGVWSFGVLLWEIFSLGASPYPGVKIDEKFCRRLKEGTRMRAPDYTTPEMYQTMLDCWH
EDPNQRPAFSELVEHLGNLLQANAQQDGKDYIVLPMSETLSMEEDSGLSLPTSPVSCMEE
EEVCDPKFHYDNTAGISHYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDSQTDSGMVL
ASEELKTLEDRNKLSPSFGGMMPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSDEA
GLLKLVDVAGHVDSGTTLRSSPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM6433
Biotinylated VEGF-R Peptide Substrate
Name:Biotinylated VEGF-R Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:2588.40
Organism:n/a
Description:n/a
Residue:23
Sequence:
(Biotin)KHKKLAEGSAYEEV-Amide