| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interstitial collagenase [100-268] |
|---|
| Ligand | BDBM7459 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | cd-MMP-1 Activity Assay |
|---|
| pH | 7.5±n/a |
|---|
| IC50 | 3.03e+3±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Lu, W; Zhu, J; Zou, S; Li, X; Huang, J The efficient expression of human fibroblast collagenase in Escherichia coli and the discovery of flavonoid inhibitors. J Enzyme Inhib Med Chem28:741-6 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interstitial collagenase [100-268] |
|---|
| Name: | Interstitial collagenase [100-268] |
|---|
| Synonyms: | CLG | MMP1 | MMP1_HUMAN | Matrix metalloproteinase-1 (cd-MMP-1) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18886.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Catalytic domain of human MMP-1 (100-268 aa) |
|---|
| Residue: | 169 |
|---|
| Sequence: | FVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADI
MISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHE
LGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQ
|
|
|
|---|
| BDBM7459 |
|---|
| n/a |
|---|
| Name | BDBM7459 |
|---|
| Synonyms: | 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one | 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-chromen-4-one | CHEMBL151 | Luteolin (27) | Luteolin (4) | acs.jmedchem.1c00409_ST.600 | cid_5280445 | luteolin | med.21724, Compound 3 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H10O6 |
|---|
| Mol. Mass. | 286.2363 |
|---|
| SMILES | Oc1cc(O)c2c(c1)oc(cc2=O)-c1ccc(O)c(O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
