Reaction Details |
| Report a problem with these data |
Target | Microsomal glutathione S-transferase 1 |
---|
Ligand | BDBM237182 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Glutathione S-transferase Activity Assay |
---|
pH | 6.5±n/a |
---|
Ki | 164730±n/a nM |
---|
IC50 | 278300±n/a nM |
---|
Comments | extracted |
---|
Citation | Ekinci, D; Cankaya, M; Gül, Ä°; Coban, TA Susceptibility of cord blood antioxidant enzymes glutathione reductase, glutathione peroxidase and glutathione S-transferase to different antibiotics: in vitro approach. J Enzyme Inhib Med Chem28:824-9 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Microsomal glutathione S-transferase 1 |
---|
Name: | Microsomal glutathione S-transferase 1 |
Synonyms: | GST12 | Glutathione S-transferase (GST) | MGST | MGST1 | MGST1_HUMAN |
Type: | Enzyme |
Mol. Mass.: | 17605.01 |
Organism: | Homo sapiens (Human) |
Description: | P10620 |
Residue: | 155 |
Sequence: | MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAK
KYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIA
YLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL
|
|
|
BDBM237182 |
---|
n/a |
---|
Name | BDBM237182 |
Synonyms: | Ceftizoxime |
Type | Small organic molecule |
Emp. Form. | C13H13N5O5S2 |
Mol. Mass. | 383.403 |
SMILES | CO\N=C(/C(=O)N[C@H]1[C@H]2SCC=C(N2C1=O)C(O)=O)c1csc(N)n1 |c:11| |
Structure |
|