Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein phosphatase non-receptor type 2
LigandBDBM243059
Substrate/Competitorn/a
Meas. Tech.Enzymatic Assay
pH6.5±0
Temperature303.15±0 K
IC50 8.82e+3± 1.29e+3 nM
Citation Sun LPMa WPGao LXYang LLQuan YCLi JPiao HR Synthesis and characterization of 5,7-dihydroxyflavanone derivatives as novel protein tyrosine phosphatase 1B inhibitors. J Enzyme Inhib Med Chem 28:1199-204 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein phosphatase non-receptor type 2
Name:Tyrosine-protein phosphatase non-receptor type 2
Synonyms:T-cell protein tyrosine phosphatase (TCPTP) | T-cell protein-tyrosine phosphatase | TC-PTP | TCPTP | Tyrosine-protein phosphatase non-receptor type 2 (TC-PTP)
Type:Protein
Mol. Mass.:48481.80
Organism:Homo sapiens (Human)
Description:P17706
Residue:415
Sequence:
MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPA
FDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM243059
n/a
NameBDBM243059
Synonyms:PTP inhibitor, 4k
TypeSmall organic molecule
Emp. Form.C16H11F3O4
Mol. Mass.324.2513
SMILESOc1cc(O)c2C(=O)CC(Oc2c1)c1cccc(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: