Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity phosphatase Cdc25B
LigandBDBM243059
Substrate/Competitorn/a
Meas. Tech.Enzymatic Assay
pH6.5±0
Temperature303.15±0 K
IC50 8.54e+3± 1.51e+3 nM
Citation Sun LPMa WPGao LXYang LLQuan YCLi JPiao HR Synthesis and characterization of 5,7-dihydroxyflavanone derivatives as novel protein tyrosine phosphatase 1B inhibitors. J Enzyme Inhib Med Chem 28:1199-204 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificity phosphatase Cdc25B
Name:Dual specificity phosphatase Cdc25B
Synonyms:Dual specificity phosphatase (CDC25B) | M-phase inducer phosphatase 2 (CDC25B)
Type:Protein
Mol. Mass.:64985.27
Organism:Homo sapiens (Human)
Description:n/a
Residue:580
Sequence:
MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMH
DLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMD
PHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEA
GSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPD
RKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLKDDDAVPPGMESLISAPLVKT
LEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQ
QEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETM
VALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKR
VILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQ
DYRPMNHEAFKDELKTFRLKTRSWAGERSRRELCSRLQDQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM243059
n/a
NameBDBM243059
Synonyms:PTP inhibitor, 4k
TypeSmall organic molecule
Emp. Form.C16H11F3O4
Mol. Mass.324.2513
SMILESOc1cc(O)c2C(=O)CC(Oc2c1)c1cccc(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: