Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCoagulation factor X
LigandBDBM294039
Substrate/Competitorn/a
Meas. Tech.Rat Coagulation Factor Xa Assay
pH8.3±n/a
Ki 2.87±n/a nM
Commentsextracted
Citation Chen SDing ZGong GYan XHuang WGuo FDuan BGao RZhou PLu XDong G Preparation method for benzoxazoleoxazine ketone compound and intermediate and crystal form thereof US Patent  US10106557 Publication Date 10/23/2018
More Info.:Get all data from this article,  Assay Method
 
Coagulation factor X
Name:Coagulation factor X
Synonyms:Coagulation factor X precursor | F10 | Factor Xa (fXa) | Stuart factor
Type:Enzyme
Mol. Mass.:54255.03
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:482
Sequence:
MESPVRLSLLYVVLASLLLPGRSVFINRERANNVLQRIRRANSFFEEIKKGNLERECVEE
ICSFEEAREVFEDNEKTTEFWNKYEDGDQCESSPCQNQGECRDGLGSYTCTCTEGFEGKN
CELFVRKLCSLDNGDCDQFCREEQNSVVCSCAKGYFLGNDGKSCLSTAPFPCGKTNKGRA
KRSVALNTSNSEPDPEDLMPDADILYPTESPSELLNLNKTEPEANSDDVIRIVGGQECKR
GECPWQALLFSDEETDGFCGGTILNEFYILTAAHCLHQAKRFKVRVGDLNTEQEDGGEMV
HEVDMIIKHNKFQRDTYDFDIAMLRLKTPITFRENVAPACLPQKDWAEATLMTQKTGIVS
GFGRTHEKGRQSKVLKMMEVPYVDRNTCRLSTSFSITQNMFCAGYDAKQEDACQGDSGGP
HVTRFKDTYFVTGIVSWGEGCARKGKYGIYTKVTAFLKWIDRSMKARVGPTSETPRLTHP
PY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM294039
n/a
NameBDBM294039
Synonyms:Process 1 | US10106557, Compound 1
TypeSmall organic molecule
Emp. Form.C18H18N2O5
Mol. Mass.342.3459
SMILESOc1cc(ccc1NC(=O)OCc1ccccc1)N1CCOCC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: