Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPancreatic lipase
LigandBDBM64584
Substrate/CompetitorBDBM246504
Meas. Tech.In Vitro Pancreatic Lipase Assay
pH7.4±0
Temperature310.15±0 K
Ki 6.45e+3± 1.32e+3 nM
IC50 2.920e+4± 6.26e+3 nM
Citation Yang MHChin YWYoon KDKim J Phenolic compounds with pancreatic lipase inhibitory activity from Korean yam (Dioscorea opposita). J Enzyme Inhib Med Chem 29:1-6 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Pancreatic lipase
Name:Pancreatic triacylglycerol lipase
Synonyms:PL | PTL | Pancreatic triacylglycerol lipase
Type:Enzyme
Mol. Mass.:50080.69
Organism:Sus scrofa (Pig)
Description:P00591
Residue:450
Sequence:
SEVCFPRLGCFSDDAPWAGIVQRPLKILPWSPKDVDTRFLLYTNQNQNNYQELVADPSTI
TNSNFRMDRKTRFIIHGFIDKGEEDWLSNICKNLFKVESVNCICVDWKGGSRTGYTQASQ
NIRIVGAEVAYFVEVLKSSLGYSPSNVHVIGHSLGSHAAGEAGRRTNGTIERITGLDPAE
PCFQGTPELVRLDPSDAKFVDVIHTDAAPIIPNLGFGMSQTVGHLDFFPNGGKQMPGCQK
NILSQIVDIDGIWEGTRDFVACNHLRSYKYYADSILNPDGFAGFPCDSYNVFTANKCFPC
PSEGCPQMGHYADRFPGKTNGVSQVFYLNTGDASNFARWRYKVSVTLSGKKVTGHILVSL
FGNEGNSRQYEIYKGTLQPDNTHSDEFDSDVEVGDLQKVKFIWYNNNVINPTLPRVGASK
ITVERNDGKVYDFCSQETVREEVLLTLNPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM64584
BDBM246504
NameBDBM64584
Synonyms:2',3,5-Trihydroxybibenzyl (2)
Typen/a
Emp. Form.C14H14O3
Mol. Mass.230.2592
SMILESOc1cc(O)cc(CCc2ccccc2O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: