Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 12
LigandBDBM10880
Substrate/Competitorn/a
Meas. Tech.Thermal Shift Assay (TSA)
pH7±n/a
Kd 133±n/a nM
Commentsextracted
Citation Zubriene ACapkauskaite EGylyte JKi?onaite MTumkevicius SMatulis D Benzenesulfonamides with benzimidazole moieties as inhibitors of carbonic anhydrases I, II, VII, XII and XIII. J Enzyme Inhib Med Chem 29:124-31 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 12
Name:Carbonic anhydrase
Synonyms:CA-XII | Carbonate dehydratase XII | Carbonic anhydrase 12 (CA XII) | Carbonic anhydrase XII (CA XII) | Carbonic anhydrase XII (CAXII) | Tumor antigen HOM-RCC-3.1.3
Type:Enzyme
Mol. Mass.:39456.00
Organism:Homo sapiens (Human)
Description:Catalytic domain of human cloned isozyme was used in the assay
Residue:354
Sequence:
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN
PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL
SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10880
n/a
NameBDBM10880
Synonyms:AZA | AZA2 | AZM acetazolamide | Acerazolamide, AAZ | Acetazolamide | Acetazolamide (AAZ) | Acetazolamide (AZA) | Acetazolamide (AZM) | Acetazolamide, 5 | Acetazolamide, AAZ | Acetazolamide, AZA | Acetazolamide, AZM | CHEMBL20 | N-(5-sulfamoyl-1,3,4-thiadiazol-2-yl)acetamide | Sulfonamide, 1 | US10172837, Acetazolamide | sulfonamide 1
TypeSmall organic molecule
Emp. Form.C4H6N4O3S2
Mol. Mass.222.245
SMILESCC(=O)Nc1nnc(s1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: