Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 1
LigandBDBM50022178
Substrate/Competitorn/a
Meas. Tech.CA Inhibition Assay
pH7.5±n/a
Temperature277.15±n/a K
Ki 4.8e+3± 0 nM
Commentsextracted
Citation Sharma ATiwari MSupuran CT Novel coumarins and benzocoumarins acting as isoform-selective inhibitors against the tumor-associated carbonic anhydrase IX. J Enzyme Inhib Med Chem 29:292-6 (2014) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 1
Name:Carbonic anhydrase
Synonyms:CA-I | CAB | Carbonate dehydratase I | Carbonic anhydrase 1 (CA I) | Carbonic anhydrase 1 (CA-I) | Carbonic anhydrase 1 (Recombinant CA I) | Carbonic anhydrase 2 (CA II) | Carbonic anhydrase B | Carbonic anhydrase I (CA I) | Carbonic anhydrase I (CA-I) | Carbonic anhydrase I (CAI) | Carbonic anhydrase I (hCA I) | Carbonic anhydrase isoenzyme I (hCA I) | hCA
Type:Enzyme
Mol. Mass.:28873.37
Organism:Homo sapiens (Human)
Description:P00915
Residue:261
Sequence:
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50022178
n/a
NameBDBM50022178
Synonyms:4-Methyl-7-hydroxycoumarin | 4-methylumbelliferone | 7-Hydroxy-4-methyl-2-oxo-2H-1-benzopyran | 7-Hydroxy-4-methyl-2-oxo-3-chromene | 7-Hydroxy-4-methyl-2H-1-benzopyran-2-one | 7-Hydroxy-4-methyl-2H-2-one (1) | 7-Hydroxy-4-methylcoumarin | 7-hydroxy-4-methyl-2H-chromen-2-one | CHEMBL12208 | Coumarin derivative, 3b | Imecromone | beta-Methylumbelliferone | cid_5280567
TypeSmall organic molecule
Emp. Form.C10H8O3
Mol. Mass.176.1687
SMILESCc1cc(=O)oc2cc(O)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: