Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 9
LigandBDBM50022178
Substrate/Competitorn/a
Meas. Tech.CA Inhibition Assay
pH7.5±n/a
Temperature277.15±n/a K
Ki 4.5e+2± 0 nM
Commentsextracted
Citation Sharma ATiwari MSupuran CT Novel coumarins and benzocoumarins acting as isoform-selective inhibitors against the tumor-associated carbonic anhydrase IX. J Enzyme Inhib Med Chem 29:292-6 (2014) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 9
Name:Carbonic anhydrases; II & IX
Synonyms:CA-IX | Carbonate dehydratase IX | Carbonic anhydrase 9 (CA IX) | Carbonic anhydrase 9 (CAIX) | Carbonic anhydrase 9 precursor | Carbonic anhydrase IX (CA IX) | Carbonic anhydrase IX (CAIX) | Membrane antigen MN | RCC-associated antigen G250
Type:Enzyme
Mol. Mass.:49669.03
Organism:Homo sapiens (Human)
Description:Catalytic domain of human cloned isozyme was used in the assay
Residue:459
Sequence:
MAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLVPVHPQRLPRMQEDSPLGGGSSGEDDPL
GEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPG
DPQEPQNNAHRDKEGDDQSHWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPL
ELLGFQLPPLPELRLRNNGHSVQLTLPPGLEMALGPGREYRALQLHLHWGAAGRPGSEHT
VEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIA
EEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHTLS
DTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCLAAGDILALVF
GLLFAVTSVAFLVQMRRQHRRGTKGGVSYRPAEVAETGA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50022178
n/a
NameBDBM50022178
Synonyms:4-Methyl-7-hydroxycoumarin | 4-methylumbelliferone | 7-Hydroxy-4-methyl-2-oxo-2H-1-benzopyran | 7-Hydroxy-4-methyl-2-oxo-3-chromene | 7-Hydroxy-4-methyl-2H-1-benzopyran-2-one | 7-Hydroxy-4-methyl-2H-2-one (1) | 7-Hydroxy-4-methylcoumarin | 7-hydroxy-4-methyl-2H-chromen-2-one | CHEMBL12208 | Coumarin derivative, 3b | Imecromone | beta-Methylumbelliferone | cid_5280567
TypeSmall organic molecule
Emp. Form.C10H8O3
Mol. Mass.176.1687
SMILESCc1cc(=O)oc2cc(O)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: