| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase [110-330] |
|---|
| Ligand | BDBM36181 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Stopped Flow CO2 Hydration Assay |
|---|
| pH | 8.3±n/a |
|---|
| Temperature | 293.15±n/a K |
|---|
| Ki | 64500±n/a nM |
|---|
| Citation |  Dathan, NA; Alterio, V; Troiano, E; Vullo, D; Ludwig, M; De Simone, G; Supuran, CT; Monti, SM Biochemical characterization of the chloroplastic ß-carbonic anhydrase from Flaveria bidentis (L.) "Kuntze". J Enzyme Inhib Med Chem29:500-4 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Carbonic anhydrase [110-330] |
|---|
| Name: | Carbonic anhydrase [110-330] |
|---|
| Synonyms: | CAHX_FLABI | Carbonic anhydrase (CA1) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 24226.97 |
|---|
| Organism: | Flaveria bidentis (Coastal plain yellowtops) |
|---|
| Description: | Truncated version without chloroplast transit peptide (1-109) |
|---|
| Residue: | 221 |
|---|
| Sequence: | QAAAPDTKAPFDPVERIKSGFVKFKTEKFVTNPALYDELAKGQSPKFMVFACSDSRVCPS
HVLDFQPGEAFVVRNVANMVPPFDKTKYSGVGAAVEYAVLHLKVQEIFVIGHSRCGGIKG
LMTFPDEGPHSTDFIEDWVKVCLPAKSKVVAEHNGTHLDDQCVLCEKEAVNVSLGNLLTY
PFVRDGLRNKTLALKGGHYDFVNGTFELWALDFGLSSPTSV
|
|
|
|---|
| BDBM36181 |
|---|
| n/a |
|---|
| Name | BDBM36181 |
|---|
| Synonyms: | SODIUM BENZOATE | benzoate | benzoic acid | benzoic acid-d5 |
|---|
| Type | Guest |
|---|
| Emp. Form. | C7H5O2 |
|---|
| Mol. Mass. | 121.1139 |
|---|
| SMILES | [O-]C(=O)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
