| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bromodomain-containing protein 4 [368-440] |
|---|
| Ligand | BDBM249279 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Homogeneous Time Resolved Fluorescence Resonance Energy Transfer (TR-FRET) Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 65.5±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Aktoudianakis, E; Chin, G; Corkey, BK; Du, J; Elbel, K; Jiang, RH; Kobayashi, T; Lee, R; Martinez, R; Metobo, SE; Mish, M; Munoz, M; Shevick, S; Sperandio, D; Yang, H; Zablocki, J Benzimidazole derivatives as bromodomain inhibitors US Patent US9458145 Publication Date 10/4/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bromodomain-containing protein 4 [368-440] |
|---|
| Name: | Bromodomain-containing protein 4 [368-440] |
|---|
| Synonyms: | BRD4 | BRD4_HUMAN | Bromo domain 2 | Bromodomain-containing protein 4 (BD2) | Bromodomain-containing protein 4 (BRD4) Bromo 2 | Bromodomain-containing protein 4 (BRD4)(BD2) | Bromodomain-containing protein 4 (BRD4)(Bromo 2) | Bromodomain-containing protein 4 Bromo 2 domain(BRD4 BD2) | Bromodomain-containing protein 4 Bromodomain 2 (BRD4-2) | Bromodomain-containing protein 4 Domain 2 | HUNK1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 8564.63 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | BD2 (368-440 aa) of O60885 |
|---|
| Residue: | 73 |
|---|
| Sequence: | KHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFS
NCYKYNPPDHEVV
|
|
|
|---|
| BDBM249279 |
|---|
| n/a |
|---|
| Name | BDBM249279 |
|---|
| Synonyms: | US10017501, Compound 1020-28 | US9458145, 1020-28 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H25N3O |
|---|
| Mol. Mass. | 335.4427 |
|---|
| SMILES | CC\C=C(/CC)c1cc(cc2nc([nH]c12)C1CC1)-c1c(C)noc1C |
|---|
| Structure | 
|
|---|
Search and Browse
