| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Alpha-carbonic anhydrase |
|---|
| Ligand | BDBM50333131 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_158306 (CHEMBL763191) |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 293.15±n/a K |
|---|
| Ki | 270000±n/a nM |
|---|
| Citation |  Del Prete, S; Vullo, D; De Luca, V; Carginale, V; di Fonzo, P; Osman, SM; AlOthman, Z; Supuran, CT; Capasso, C Anion inhibition profiles of a-, ß- and ¿-carbonic anhydrases from the pathogenic bacterium Vibrio cholerae. Bioorg Med Chem24:3413-7 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Alpha-carbonic anhydrase |
|---|
| Name: | Alpha-carbonic anhydrase |
|---|
| Synonyms: | hpαCA |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 28337.60 |
|---|
| Organism: | Helicobacter pylori (strain G27) |
|---|
| Description: | B5Z8I0 |
|---|
| Residue: | 247 |
|---|
| Sequence: | MKKTFLIALALTASLIGAENAKWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYY
HTQDKADLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLIN
NKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKQNFKEVALDAFLPKS
INYYHFNGSLTAPPCTEGVAWFVVEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVII
KRSAETR
|
|
|
|---|
| BDBM50333131 |
|---|
| n/a |
|---|
| Name | BDBM50333131 |
|---|
| Synonyms: | CHEMBL1075630 | sodium pyrovanadate(V) | tetrasodium {[dioxido(oxo)vanadio]oxy}(oxo)vanadiumbis(olate) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | O7V2 |
|---|
| Mol. Mass. | 213.881 |
|---|
| SMILES | [O-][V]([O-])(=O)O[V]([O-])([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
