Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocyte-stimulating hormone receptor
LigandBDBM250653
Substrate/Competitorn/a
Meas. Tech.cAMP Assay
pH7.5±n/a
Temperature310.15±n/a K
EC50 0.004±n/a nM
Commentsextracted
Citation Yang WShi Y Melanocortin-1 receptor-specific cyclic peptides US Patent  US9447148 Publication Date 9/20/2016
More Info.:Get all data from this article,  Assay Method
 
Melanocyte-stimulating hormone receptor
Name:Melanocyte-stimulating hormone receptor
Synonyms:MC1-R | MSH-R | Melanocortin MC1 | Melanocortin receptor 1 (MC-1) | Melanocortin receptor 1 (MC1-R) | Melanocortin receptor 1 (MC1R)
Type:Enzyme
Mol. Mass.:34717.23
Organism:Homo sapiens (Human)
Description:Q01726
Residue:317
Sequence:
MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVV
ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVI
DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFI
AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA
VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
HSQELRRTLKEVLTCSW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM250653
n/a
NameBDBM250653
Synonyms:US9447148, 9.22
TypeSmall organic molecule
Emp. Form.C49H66N14O8
Mol. Mass.979.1373
SMILESNC(=N)NCCC[C@@H]1NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@H](Cc2c[nH]cn2)NC(=O)[C@H](CCC(=O)NCC[C@H](NC1=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(N)=O)NC(=O)CC1CCCCC1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: