Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase mTOR
LigandBDBM251652
Substrate/Competitorn/a
Meas. Tech.LanthaScreen Kinase Activity Assay
pH7.5±n/a
Temperature298.15±n/a K
IC50 58±n/a nM
Commentsextracted
Citation Pastor Fernández JFernández-Capetillo Ruiz OMartínez González SBlanco Aparicio CRico Ferreira MToledo Lázaro LIRodríguez Arísteguí SMurga Costa MVarela Busto CLopez Contreras AJRenner ONieto Soler MCebrián Muñoz DA Chemical entities US Patent  US9453031 Publication Date 9/27/2016
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase mTOR
Name:Serine/threonine-protein kinase mTOR
Synonyms:n/a
Type:Enzyme
Mol. Mass.:136306.16
Organism:Homo sapiens (Human)
Description:aa 1360-2549
Residue:1190
Sequence:
LAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISI
NNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLG
RMRCLEALGEWGQLHQQCCEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRD
THDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSEL
EEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASL
CGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQH
FVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAA
TEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKKKLRHASGANITNATTAATTAATAT
TTASTEGSNSESEAESTENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNN
LQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQ
LLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRV
AILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLM
EAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELA
VPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVM
QLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKI
LLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTN
YTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRL
TRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGN
KRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQ
IINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM251652
n/a
NameBDBM251652
Synonyms:US9453031, 103
TypeSmall organic molecule
Emp. Form.C22H26N4O4S
Mol. Mass.442.531
SMILESCc1cc2c(cccc2[nH]1)-c1nc2N3CCOC[C@H]3COc2c(n1)C(C)(C)S(C)(=O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: