| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Complement factor D |
|---|
| Ligand | BDBM254528 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Human Complement Factor D Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 5±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Altmann, E; Hommel, U; Lorthiois, EL; Maibaum, JK; Ostermann, N; Quancard, J; Randl, SA; Rogel, O; Vulpetti, A Pyrrolidine derivatives and their use as complement pathway modulators US Patent US9468661 Publication Date 10/18/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Complement factor D |
|---|
| Name: | Complement factor D |
|---|
| Synonyms: | Adipsin | C3 convertase activator | CFAD_HUMAN | CFD | DF | PFD | Properdin factor D |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 27039.19 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00746 |
|---|
| Residue: | 253 |
|---|
| Sequence: | MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
|
|
|
|---|
| BDBM254528 |
|---|
| n/a |
|---|
| Name | BDBM254528 |
|---|
| Synonyms: | US9468661, 106 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H25Cl2N5O4S |
|---|
| Mol. Mass. | 562.468 |
|---|
| SMILES | CC(=O)c1nn(CC(=O)N2[C@@H]3C[C@@H]3C[C@H]2C(=O)NC[C@H]2CC2(Cl)Cl)c2ccc(OCc3nccs3)cc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
