| Reaction Details |
|---|
 | Report a problem with these data |
| Target | chymase |
|---|
| Ligand | BDBM256046 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzymatic Chymase Assay |
|---|
| pH | 7.5±n/a |
|---|
| IC50 | 2±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Fürstner, C; Ackerstaff, J; Straub, A; Meier, H; Tinel, H; Zimmermann, K; Tersteegen, A; Zubov, D; Kast, R; Schamberger, J; Schäfer, M; Börngen, K Bicyclically substituted uracils and the use thereof US Patent US9481672 Publication Date 11/1/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| chymase |
|---|
| Name: | chymase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 27507.42 |
|---|
| Organism: | Mesocricetus auratus (Golden hamster) |
|---|
| Description: | A0A1U7QTH6 |
|---|
| Residue: | 247 |
|---|
| Sequence: | MLLPALRLLLFLLGSSAEAGKIIGGTECRPHARPYMAYLEIVTPENHLSACSGFLIRRNF
VMTAAHCAGRSITVLLGAHNKKVKEDTWQKLEVEKQFPHPKYDDHLVLNDIMLLKLKEKA
NLTLGVGTLPISAKSNSIPPGRVCRAVGWGRTNVNEPPSDTLQEVKMRILDPQACKHFED
FHQEPQLCVGNPKKIRNVYKGDSGGPLLCAGIAQGIASYVLRNAKPPSVFTRISHYRPWI
NKILREN
|
|
|
|---|
| BDBM256046 |
|---|
| n/a |
|---|
| Name | BDBM256046 |
|---|
| Synonyms: | US9481672, 227 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H20F3N3O5 |
|---|
| Mol. Mass. | 511.4493 |
|---|
| SMILES | CN1C(=O)C2(CC2)c2cc(ccc12)-n1cc(C(O)=O)c(=O)n([C@@H]2CCc3c2cccc3C(F)(F)F)c1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
