Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTransient receptor potential cation channel subfamily M member 8 (TRPM8)
LigandBDBM256277
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Temperature310.15±n/a K
IC50 0.3±n/a nM
Commentsextracted
Citation Kato TSakamoto TKubo ASawamoto D Sulfonamide compound US Patent  US9487488 Publication Date 11/8/2016
More Info.:Get all data from this article,  Assay Method
 
Transient receptor potential cation channel subfamily M member 8 (TRPM8)
Name:Transient receptor potential cation channel subfamily M member 8 (TRPM8)
Synonyms:Transient receptor potential M8 protein (TRPM8) | Transient receptor potential cation channel subfamily M member 8
Type:Enzyme
Mol. Mass.:127693.26
Organism:Homo sapiens (Human)
Description:Q7Z2W7
Residue:1104
Sequence:
MSFRAARLSMRNRRNDTLDSTRTLYSSASRSTDLSYSESDLVNFIQANFKKRECVFFTKD
SKATENVCKCGYAQSQHMEGTQINQSEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYIRL
SCDTDAEILYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWIL
TGGTHYGLMKYIGEVVRDNTISRSSEENIVAIGIAAWGMVSNRDTLIRNCDAEGYFLAQY
LMDDFTRDPLYILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP
IVCFAQGGGKETLKAINTSIKNKIPCVVVEGSGQIADVIASLVEVEDALTSSAVKEKLVR
FLPRTVSRLPEEETESWIKWLKEILECSHLLTVIKMEEAGDEIVSNAISYALYKAFSTSE
QDKDNWNGQLKLLLEWNQLDLANDEIFTNDRRWESADLQEVMFTALIKDRPKFVRLFLEN
GLNLRKFLTHDVLTELFSNHFSTLVYRNLQIAKNSYNDALLTFVWKLVANFRRGFRKEDR
NGRDEMDIELHDVSPITRHPLQALFIWAILQNKKELSKVIWEQTRGCTLAALGASKLLKT
LAKVKNDINAAGESEELANEYETRAVELFTECYSSDEDLAEQLLVYSCEAWGGSNCLELA
VEATDQHFIAQPGVQNFLSKQWYGEISRDTKNWKIILCLFIIPLVGCGFVSFRKKPVDKH
KKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFAYVLLMDFHSVPHPPELVLYSLVFVLFC
DEVRQWYVNGVNYFTDLWNVMDTLGLFYFIAGIVFRLHSSNKSSLYSGRVIFCLDYIIFT
LRLIHIFTVSRNLGPKIIMLQRMLIDVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIF
RSVIYEPYLAMFGQVPSDVDGTTYDFAHCTFTGNESKPLCVELDEHNLPRFPEWITIPLV
CIYMLSTNILLVNLLVAMFGYTVGTVQENNDQVWKFQRYFLVQEYCSRLNIPFPFIVFAY
FYMVVKKCFKCCCKEKNMESSVCCFKNEDNETLAWEGVMKENYLVKINTKANDTSEEMRH
RFRQLDTKLNDLKGLLKEIANKIK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM256277
n/a
NameBDBM256277
Synonyms:US9487488, 1
TypeSmall organic molecule
Emp. Form.C27H21F3N6O3S
Mol. Mass.566.554
SMILESFC(F)(F)Oc1ccc(CN(c2ncc3ccccc3c2C2CC2)S(=O)(=O)c2ccc(cc2)-c2nnn[nH]2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: