Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM Kinase II
LigandBDBM6845
Substrate/CompetitorAutocamtide-2
Meas. Tech.CDK Kinase Inhibition Assay
Temperature298.15±n/a K
IC50 403±n/a nM
Commentsextracted
Citation Engler TAFurness KMalhotra SSanchez-Martinez CShih CXie WZhu GZhou XConner SFaul MMSullivan KAKolis SPBrooks HBPatel BSchultz RMDeHahn TBKirmani KSpencer CDWatkins SAConsidine ELDempsey JAOgg CAStamm NBAnderson BDCampbell RMVasudevan VLytle ML Novel, potent and selective cyclin D1/CDK4 inhibitors: indolo[6,7-a]pyrrolo[3,4-c]carbazoles. Bioorg Med Chem Lett 13:2261-7 (2003) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
CaM Kinase II
Name:CaM Kinase II
Synonyms:Calcium/calmodulin-dependent protein kinase type II, rat brain | calcium/calmodulin-dependent protein kinase II alpha subunit
Type:Enzyme Mixture
Mol. Mass.:54120.65
Organism:Rattus norvegicus (rat)
Description:Consists of subunits of M.W. 50,000 and 58,000-60,000 in a 3:1 ratio.
Residue:478
Sequence:
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM6845
Autocamtide-2
Name:Autocamtide-2
Synonyms:n/a
Type:Peptide
Mol. Mass.:3697.73
Organism:n/a
Description:n/a
Residue:36
Sequence:
Lys-Lys-Ala-Leu-Arg-Arg-Gln-Glu-Thr-Val-Asp-Ala-Leu