BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM295696
Substrate/Competitorn/a
Meas. Tech.CB2 cAMP (Assay 1)
EC50 0.230±n/a nM
Citation Riether DBinder FPDoods HMueller SGNicholson JRSauer A (Cyano-dimethyl-methyl)-isoxazoles and -[1,3,4]thiadiazoles US Patent  US10112934 Publication Date 10/30/2018  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM295696
n/a
NameBDBM295696
Synonyms:US10112934, Example 5
TypeSmall organic molecule
Emp. Form.C18H29N5O4S
Mol. Mass.411.519
SMILESCN(C1CCN(CC1)S(C)(=O)=O)C(C)(C)C(=O)Nc1cc(no1)C(C)(C)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: