Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM Kinase II
LigandBDBM6864
Substrate/CompetitorAutocamtide-2
Meas. Tech.Kinase Inhibition Assay
Temperature298.15±n/a K
IC50 82±n/a nM
Commentsextracted
Citation Zhu GConner SEZhou XShih CLi TAnderson BDBrooks HBCampbell RMConsidine EDempsey JAFaul MMOgg CPatel BSchultz RMSpencer CDTeicher BWatkins SA Synthesis, structure-activity relationship, and biological studies of indolocarbazoles as potent cyclin D1-CDK4 inhibitors. J Med Chem 46:2027-30 (2003) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
CaM Kinase II
Name:CaM Kinase II
Synonyms:Calcium/calmodulin-dependent protein kinase type II, rat brain | calcium/calmodulin-dependent protein kinase II alpha subunit
Type:Enzyme Mixture
Mol. Mass.:54120.65
Organism:Rattus norvegicus (rat)
Description:Consists of subunits of M.W. 50,000 and 58,000-60,000 in a 3:1 ratio.
Residue:478
Sequence:
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM6864
Autocamtide-2
Name:Autocamtide-2
Synonyms:n/a
Type:Peptide
Mol. Mass.:3697.73
Organism:n/a
Description:n/a
Residue:36
Sequence:
Lys-Lys-Ala-Leu-Arg-Arg-Gln-Glu-Thr-Val-Asp-Ala-Leu