| Reaction Details |
|---|
 | Report a problem with these data |
| Target | cAMP-dependent protein kinase catalytic subunit alpha |
|---|
| Ligand | BDBM6870 |
|---|
| Substrate/Competitor | PKA Peptide Substrate |
|---|
| Meas. Tech. | Kinase Inhibition Assay |
|---|
| IC50 | 4300±n/a nM |
|---|
| Citation |  Lin, R; Connolly, PJ; Huang, S; Wetter, SK; Lu, Y; Murray, WV; Emanuel, SL; Gruninger, RH; Fuentes-Pesquera, AR; Rugg, CA; Middleton, SA; Jolliffe, LK 1-Acyl-1H-[1,2,4]triazole-3,5-diamine analogues as novel and potent anticancer cyclin-dependent kinase inhibitors: synthesis and evaluation of biological activities. J Med Chem48:4208-11 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| cAMP-dependent protein kinase catalytic subunit alpha |
|---|
| Name: | cAMP-dependent protein kinase catalytic subunit alpha |
|---|
| Synonyms: | KAPCA_BOVIN | PKA C-alpha | PKC | PRKACA | Protein Kinase C | Protein Kinase C, bovine brain | cAMP-Dependent Protein Kinase (PKA) | cAMP-dependent Protein Kinase, bovine heart | cAMP-dependent protein kinase A | cAMP-dependent protein kinase alpha-catalytic subunit | cAMP-dependent protein kinase, alpha-catalytic subunit |
|---|
| Type: | Enzyme Complex |
|---|
| Mol. Mass.: | 40627.77 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | The PKA holoenzyme purified from bovine heart, exists as an inactive tetrameric complex, which consists of a regulatory dimer associated with two catalytic subunits. It requires cAMP to activate the enzymatic reaction. |
|---|
| Residue: | 351 |
|---|
| Sequence: | MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
|
|
|
|---|
| BDBM6870 |
|---|
| PKA Peptide Substrate |
|---|
| Name: | PKA Peptide Substrate |
|---|
| Synonyms: | n/a |
|---|
| Type: | Peptide |
|---|
| Mol. Mass.: | 2018.28 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 18 |
|---|
| Sequence: | |
|---|
Search and Browse
