Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetERK-2
LigandBDBM6867
Substrate/CompetitorERK-2 Peptide Substrate
Meas. Tech.Kinase Inhibition Assay
IC50 9500±n/a nM
Citation Lin RConnolly PJHuang SWetter SKLu YMurray WVEmanuel SLGruninger RHFuentes-Pesquera ARRugg CAMiddleton SAJolliffe LK 1-Acyl-1H-[1,2,4]triazole-3,5-diamine analogues as novel and potent anticancer cyclin-dependent kinase inhibitors: synthesis and evaluation of biological activities. J Med Chem 48:4208-11 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
ERK-2
Name:ERK-2
Synonyms:ERT1 | Extracellular signal-regulated kinase 2 | MAP kinase 2 | MAPK 2 | Mitogen-activated protein kinase 2 | p42-MAPK
Type:Enzyme
Mol. Mass.:41278.65
Organism:Rattus norvegicus (rat)
Description:MAP Kinase is the rat ERK-2 isoform containing a polyhistidine tag at the N-terminus produced in E.coli. and activated by phosphorylation with MEK1 prior to purification.
Residue:358
Sequence:
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQ
TYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLS
NDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTG
FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG
ILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRI
EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM6867
ERK-2 Peptide Substrate
Name:ERK-2 Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:1969.25
Organism:n/a
Description:n/a
Residue:18
Sequence:
(Biotin)APRTPGGRR-Amide