Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM Kinase II
LigandBDBM6867
Substrate/CompetitorCaM Kinase II Peptide Substrate
Meas. Tech.Kinase Inhibition Assay
IC50>100000±n/a nM
Citation Lin RConnolly PJHuang SWetter SKLu YMurray WVEmanuel SLGruninger RHFuentes-Pesquera ARRugg CAMiddleton SAJolliffe LK 1-Acyl-1H-[1,2,4]triazole-3,5-diamine analogues as novel and potent anticancer cyclin-dependent kinase inhibitors: synthesis and evaluation of biological activities. J Med Chem 48:4208-11 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
CaM Kinase II
Name:CaM Kinase II
Synonyms:Calcium/calmodulin-dependent protein kinase type II, rat brain | calcium/calmodulin-dependent protein kinase II alpha subunit
Type:Enzyme Mixture
Mol. Mass.:54120.65
Organism:Rattus norvegicus (rat)
Description:Consists of subunits of M.W. 50,000 and 58,000-60,000 in a 3:1 ratio.
Residue:478
Sequence:
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM6867
CaM Kinase II Peptide Substrate
Name:CaM Kinase II Peptide Substrate
Synonyms:CaM Kinase II Peptide Substrate
Type:Peptide
Mol. Mass.:2528.92
Organism:n/a
Description:n/a
Residue:22
Sequence:
(Biotin)KKALRRQETVDAL-Amide