Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM7051 |
---|
Substrate/Competitor | Fluorescent peptide substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
Ki | 1.1±n/a nM |
---|
Citation | Nugiel, DA; Jacobs, K; Kaltenbach, RF; Worley, T; Patel, M; Meyer, DT; Jadhav, PK; De Lucca, GV; Smyser, TE; Klabe, RM; Bacheler, LT; Rayner, MM; Seitz, SP Preparation and structure-activity relationship of novel P1/P1'-substituted cyclic urea-based human immunodeficiency virus type-1 protease inhibitors. J Med Chem39:2156-69 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [489-587] |
---|
Name: | Dimer of Gag-Pol polyprotein [489-587] |
Synonyms: | HIV-1 Protease |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM7051 |
---|
Fluorescent peptide substrate |
---|
Name: | Fluorescent peptide substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 4608.75 |
Organism: | n/a |
Description: | n/a |
Residue: | 42 |
Sequence: | 2-aminobenzoyl-Ala-Thr-His-Gln-Val-Tyr-Phe(NO2)-Val-Arg-Lys-
Ala
|
|
|