Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 4 Isoform C
LigandBDBM50365262
Substrate/Competitorn/a
Kd 3800±n/a nM
Citation Landau SBKagey M Bromodomain inhibitors US Patent  US10124009 Publication Date 11/13/2018
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 4 Isoform C
Name:BET bromodomain 4 (BRD4)
Synonyms:n/a
Type:n/a
Mol. Mass.:80477.46
Organism:Homo sapiens (Human)
Description:O60885-2
Residue:722
Sequence:
MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQT
NQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYW
NAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRG
RGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMT
VVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTI
DPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGI
LKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGA
DVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVV
APPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKE
KDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYE
SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLK
PSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETG
PA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50365262
n/a
NameBDBM50365262
Synonyms: (S)-JQ1 (1) | CHEMBL1957266 | JQ1 | US10124009, Compound (S)-JQ1 | US10202360, Example JQ-1 | US9320741, (S)-JQ1 | US9695172, JQ1
TypeSmall organic molecule
Emp. Form.C23H25ClN4O2S
Mol. Mass.456.988
SMILESCc1nnc2[C@H](CC(=O)OC(C)(C)C)N=C(c3c(C)c(C)sc3-n12)c1ccc(Cl)cc1 |r,c:14|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: