| Reaction Details |
|---|
 | Report a problem with these data |
| Target | E3 ubiquitin-protein ligase Mdm2 [1-188] |
|---|
| Ligand | BDBM299595 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Homogenous Time-Resolved Fluorescence Assay (HTRF2 Assay) |
|---|
| IC50 | 0.200±n/a nM |
|---|
| Citation |  Bartberger, MD; Gonzalez Buenrostro, A; Beck, HP; Chen, X; Connors, RV; Deignan, J; Duquette, JA; Eksterowicz, J; Fisher, B; Fox, BM; Fu, J; Fu, Z; Gonzalez Lopez De Turiso, F; Gribble, Jr., MW; Gustin, DJ; Heath, JA; Huang, X; Jiao, X; Johnson, MG; Kayser, F; Kopecky, DJ; Lai, S; Li, Y; Li, Z; Liu, J; Low, JD; Lucas, BS; Ma, Z; McGee, LR; McIntosh, J; McMinn, DL; Medina, JC; Mihalic, JT; Olson, SH; Rew, Y; Roveto, PM; Sun, D; Wang, X; Wang, Y; Yan, X; Yu, M; Zhu, J Piperidinone derivatives as MDM2 inhibitors for the treatment of cancer US Patent US9593129 Publication Date 3/14/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| E3 ubiquitin-protein ligase Mdm2 [1-188] |
|---|
| Name: | E3 ubiquitin-protein ligase Mdm2 [1-188] |
|---|
| Synonyms: | E3 ubiquitin-protein ligase Mdm2 (aa 1-188) | MDM2 | MDM2_HUMAN |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 21319.18 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q00987[1-188] |
|---|
| Residue: | 188 |
|---|
| Sequence: | MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ
RKRHKSDS
|
|
|
|---|
| BDBM299595 |
|---|
| n/a |
|---|
| Name | BDBM299595 |
|---|
| Synonyms: | 2-((3R,5R,6S)-5-(3-chlorophenyl)-6-(4-chlorophenyl)-1-((S)-1-cyclopropyl-2-(N-(2-fluorophenyl)methylsulfonamido)ethyl)-3-methyl-2-oxopiperidin-3-yl)acetic acid | US9593129, Example 273 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H33Cl2FN2O5S |
|---|
| Mol. Mass. | 647.584 |
|---|
| SMILES | C[C@]1(CC(O)=O)C[C@@H](C(N([C@H](CN(c2ccccc2F)S(C)(=O)=O)C2CC2)C1=O)c1ccc(Cl)cc1)c1cccc(Cl)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
