Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-Dependent Kinase 1 (CDK1)
LigandBDBM7522
Substrate/CompetitorHistone H1
Meas. Tech.Kinase Inhibition Assay
Temperature303.15±n/a K
IC50 2700±n/a nM
Commentsextracted
Citation Legraverend MLudwig OBisagni ELeclerc SMeijer LGiocanti NSadri RFavaudon V Synthesis and in vitro evaluation of novel 2,6,9-trisubstituted purines acting as cyclin-dependent kinase inhibitors. Bioorg Med Chem 7:1281-93 (1999) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cyclin-Dependent Kinase 1 (CDK1)
Name:Cyclin-Dependent Kinase 1 (CDK1)
Synonyms:CDK1/Cyclin B | p34cdc2/Cyclin B
Type:Protein Complex
Mol. Mass.:n/a
Description:p34cdc2/cyclin B was purified from M-phase starfish oocytes by affinity chromatography.
Components:This complex has 2 components.
Component 1
Name:CDK1
Synonyms:Cell division control protein 2 (cdc2) | P34 protein kinase
Type:Enzyme Subunit
Mol. Mass.:358.43
Organism:Marthasterias glacialis (starfish)
Description:n/a
Residue:3
Sequence:
n/a
 
Component 2
Name:Cyclin B
Synonyms:G2/mitotic-specific cyclin-B1
Type:Enzyme Subunit
Mol. Mass.:43790.28
Organism:Marthasterias glacialis (starfish)
Description:n/a
Residue:388
Sequence:
MLNGENVDSRIMGKVATRASSKGVKSTLGTRGALENISNVARNNLQAGAKKELVKAKRGM
TKSKATSSLQSVMGLNVEPMEKAKPQSPEPMDMSEINSALEAFSQNLLEGVEDIDKNDFD
NPQLCSEFVNDIYQYMRKLEREFKVRTDYMTIQEITERMRSILIDWLVQVHLRFHLLQET
LFLTIQILDRYLEVQPVSKNKLQLVGVTSMLIAAKYEEMYPPEIGDFVYITDNAYTKAQI
RSMECNILRRLDFSLGKPLCIHFLRRNSKAGGVDGQKHTMAKYLMELTLPEYAFVPYDPS
EIAAAALCLSSKILEPDMEWGTTLVHYSAYSEDHLMPIVQKMALVLKNAPTAKFQAVRKK
YSSAKFMNVSTISALTSSTVMDLADQMC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7522
Histone H1
Name:Histone H1
Synonyms:n/a
Type:Other Protein Type
Mol. Mass.:358.43
Organism:Bos taurus (bovine)
Description:n/a
Residue:3
Sequence:
n/a