Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-Dependent Kinase 1 (CDK1)
LigandBDBM7566
Substrate/CompetitorHistone H1
Meas. Tech.Kinase Inhibition Assay
pH7.2±n/a
Temperature303.15±n/a K
IC50 2500±n/a nM
Citation Legraverend MLudwig OBisagni ELeclerc SMeijer L Synthesis of C2 alkynylated purines, a new family of potent inhibitors of cyclin-dependent kinases. Bioorg Med Chem Lett 8:793-8 (1998) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cyclin-Dependent Kinase 1 (CDK1)
Name:Cyclin-Dependent Kinase 1 (CDK1)
Synonyms:CDK1/Cyclin B | p34cdc2/Cyclin B
Type:Protein Complex
Mol. Mass.:n/a
Description:p34cdc2/cyclin B was purified from M-phase starfish oocytes by affinity chromatography.
Components:This complex has 2 components.
Component 1
Name:CDK1
Synonyms:Cell division control protein 2 (cdc2) | P34 protein kinase
Type:Enzyme Subunit
Mol. Mass.:358.43
Organism:Marthasterias glacialis (starfish)
Description:n/a
Residue:3
Sequence:
n/a
 
Component 2
Name:Cyclin B
Synonyms:G2/mitotic-specific cyclin-B1
Type:Enzyme Subunit
Mol. Mass.:43790.28
Organism:Marthasterias glacialis (starfish)
Description:n/a
Residue:388
Sequence:
MLNGENVDSRIMGKVATRASSKGVKSTLGTRGALENISNVARNNLQAGAKKELVKAKRGM
TKSKATSSLQSVMGLNVEPMEKAKPQSPEPMDMSEINSALEAFSQNLLEGVEDIDKNDFD
NPQLCSEFVNDIYQYMRKLEREFKVRTDYMTIQEITERMRSILIDWLVQVHLRFHLLQET
LFLTIQILDRYLEVQPVSKNKLQLVGVTSMLIAAKYEEMYPPEIGDFVYITDNAYTKAQI
RSMECNILRRLDFSLGKPLCIHFLRRNSKAGGVDGQKHTMAKYLMELTLPEYAFVPYDPS
EIAAAALCLSSKILEPDMEWGTTLVHYSAYSEDHLMPIVQKMALVLKNAPTAKFQAVRKK
YSSAKFMNVSTISALTSSTVMDLADQMC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7566
Histone H1
Name:Histone H1
Synonyms:n/a
Type:Other Protein Type
Mol. Mass.:358.43
Organism:Bos taurus (bovine)
Description:n/a
Residue:3
Sequence:
n/a