new BindingDB logo
myBDB logout

Assay Method Information

Assay Name:  ChEMBL_1435760
Description:  Inhibition of human ADAMTS-5 using [protein fragment, 43 aa] peptide substrate by AlphaScreen assay in presence of 50% rat plasma
Affinity data for this assay

If you find an error in this entry please send us an E-mail









About us


Email us



Last update November 1, 2007
©2000 BindingDB. All rights reserved.