Found 22 hits for monomerid = 50532312 Target/Host (Institution) | Ligand | Target/Host Links | Ligand Links | Trg + Lig Links | Ki nM | ΔG° kcal/mole | IC50 nM | Kd nM | EC50/IC50 nM | koff s-1 | kon M-1s-1 | pH | Temp °C |
A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 67 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human ADAMTS5 using 43-mer-VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate in presence of Lewis rat plasma measured after 3 hr... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
72 kDa type IV collagenase
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt UniProtKB/TrEMBL
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 1.10E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human MMP2 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
Matrix metalloproteinase 7
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 1.00E+5 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human MMP7 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 67 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human ADAMTS5 using 43-mer-VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG as substrate in presence of Lewis rat plasma measured after 3 hr... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
72 kDa type IV collagenase
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt UniProtKB/TrEMBL
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 1.10E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human MMP2 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
Matrix metalloproteinase (2 and 3)
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 6.00E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human MMP3 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
Matrix metalloproteinase (2 and 3)
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 6.00E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human MMP3 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 4 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 4 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
Collagenase 3
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 1.80E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human MMP13 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence ... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
Disintegrin and metalloproteinase domain-containing protein 17
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt UniProtKB/TrEMBL
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 1.00E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human TACE using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 4 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 4 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human ADAMTS5 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
Collagenase 3
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
NCI pathway Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 1.80E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human MMP13 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence ... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
Disintegrin and metalloproteinase domain-containing protein 17
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt UniProtKB/TrEMBL
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 1.00E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human TACE using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
Matrix metalloproteinase-9
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 4.10E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human MMP9 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
Matrix metalloproteinase 14
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB
UniProtKB/SwissProt
antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 7.80E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human MMP14 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence ... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
Interstitial collagenase
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 1.00E+5 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human MMP1 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
Interstitial collagenase
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 1.00E+5 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human MMP1 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
Matrix metalloproteinase-9
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 4.10E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human MMP9 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
Matrix metalloproteinase 14
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB
UniProtKB/SwissProt
antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 7.80E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human MMP14 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence ... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |
Matrix metalloproteinase 7
(Homo sapiens (Human)) | BDBM50532312
![PNG](/data/jpeg/tenK5053/BindingDB_50532312.png) (CHEMBL4450729)Show SMILES CCn1ccnc1[C@]1(CNC(=O)c2cc3cc(ccc3o2)C(F)(F)F)NC(=O)NC1=O |r| Show InChI InChI=1S/C19H16F3N5O4/c1-2-27-6-5-23-15(27)18(16(29)25-17(30)26-18)9-24-14(28)13-8-10-7-11(19(20,21)22)3-4-12(10)31-13/h3-8H,2,9H2,1H3,(H,24,28)(H2,25,26,29,30)/t18-/m0/s1 | PDB MMDB
Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD DrugBank antibodypedia GoogleScholar AffyNet ![](/images/AffyNet_logo.png)
| PC cid PC sid UniChem
| Article PubMed
| n/a | n/a | 1.00E+5 | n/a | n/a | n/a | n/a | n/a | n/a |
Eli Lilly and Company
Curated by ChEMBL
| Assay Description Inhibition of human MMP7 using Mca-PQGL-(3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-AR-OH as substrate measured after 2 to 4 hrs by fluorescence a... |
J Med Chem 59: 5810-22 (2016)
Article DOI: 10.1021/acs.jmedchem.6b00398 |
More data for this Ligand-Target Pair | |